DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccne2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001016267.1 Gene:ccne2 / 549021 XenbaseID:XB-GENE-923043 Length:397 Species:Xenopus tropicalis


Alignment Length:236 Identity:45/236 - (19%)
Similarity:90/236 - (38%) Gaps:36/236 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YELPSDVLFSAMSLVDRF-LDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTA 350
            |.|..:..:.|....||| |.:..|....:..:.|.:..:|.|..::.|....:...::...|:.
 Frog   155 YTLHRETFYLAQDFFDRFMLTQTCVNKSMLQLIGVTALFIASKLEEIYPPKLHEFAYVTDGACSE 219

  Fly   351 GDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALF------RNLAKEIGGDFFKFYQQLIKL-- 407
            .|:.:|..::...|..::  .|:|::::|.:|..:.      :.|..:...:.|....||:.|  
 Frog   220 DDILQMELIMLKALKWEL--YPVTAIAWLNLYLQVSSLKDHPKLLLPQYSQEQFIHVVQLLDLCI 282

  Fly   408 ---EELENRLEILMCD-----VKTTVITPST---LALVLICLHLDFHIKESYTRGSPELKHVFEY 461
               ..|:.:..||...     ..|.|:|.:|   :..:..|:|..........|.||....||:.
 Frog   283 LHHTSLDFQYRILAAAALYHFTSTEVVTKATGLDMESIGECVHWMAPFARVVKRSSPFKLKVFKK 347

  Fly   462 I--------------LFLQQYMRIPDRVFTCGFSIVSGILS 488
            :              |.:...:::||.........:.|||:
 Frog   348 VAPEDMHNIQTHANYLDMLDDVKVPDSDLGESPVAIGGILT 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/78 (19%)
ccne2NP_001016267.1 Cyclin_N 111..237 CDD:365896 16/81 (20%)
Cyclin_C 240..359 CDD:367282 22/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.