DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccnd3

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001006017.1 Gene:ccnd3 / 449996 ZFINID:ZDB-GENE-041010-110 Length:277 Species:Danio rerio


Alignment Length:161 Identity:32/161 - (19%)
Similarity:60/161 - (37%) Gaps:44/161 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 AMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIA 361
            |:..:||::.:.||:|.|:..:......||.|..:..|:.||.|...:...|:..::.:...::.
Zfish    89 AVHYLDRYMSQSAVRPCHLQLLGSVCMFLASKLRETVPLSAETLSIYTDHACSVPEILQWEVLLV 153

  Fly   362 NKLGVQMGHAPITSVSYLRI---------------------YYALFRNLAKEIGGDFFKFYQQLI 405
            :.|  |...|.:....:|.:                     |.||   .|.|:...||       
Zfish   154 SHL--QWDLASVLPSDFLELILLALPIPAQDHSSVRRHTHCYIAL---TATELKFSFF------- 206

  Fly   406 KLEELENRLEILMCDVKTTVITPSTLALVLI 436
                   |..::.|    :.:|.:.|.|.|:
Zfish   207 -------RPSVVAC----SCVTAALLRLKLL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/67 (22%)
ccnd3NP_001006017.1 Cyclin_N 36..161 CDD:278560 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.