DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccng1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001006698.1 Gene:ccng1 / 448326 XenbaseID:XB-GENE-922065 Length:295 Species:Xenopus tropicalis


Alignment Length:316 Identity:90/316 - (28%)
Similarity:150/316 - (47%) Gaps:38/316 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 SSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRRE----VTAGGRDGSAYVLRC 282
            :|:.:.|..||::|...||        ..|.|...:.|:  ||..:    :|...||.....|..
 Frog     7 TSNAQDLLCQLNSLLELEL--------KCQPKACGLRLI--ESTHDNGLRMTTKLRDFEVKDLLS 61

  Fly   283 LKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQL-DLKPIP-AEDLVTISQ 345
            |..::...::....:::|:||||.:|.|:|||:.|:.:|.|:||:|.: :.:.:| |.||:.|||
 Frog    62 LTQFFGFSTETFSLSVNLLDRFLSKMKVQPKHLGCVGLACFYLAVKAIEEERNVPLATDLLRISQ 126

  Fly   346 CGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYAL-FRNLAKEIGGDFFKFYQQLIKLEE 409
            ...|..|:.||..::..|||.::  ...|::..|.:|::| |.||.    |:..|.:.|    |.
 Frog   127 YKFTVFDMMRMEKIVLEKLGWKV--KATTALHLLHLYHSLVFDNLT----GERKKLFSQ----ER 181

  Fly   410 LENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDR 474
            |...|:...|.:..:...||.|||.::.|.:.          ..:|..:.:.:..||.:..|..|
 Frog   182 LVTHLKACHCRLGFSKAKPSVLALSILALEIQ----------EQKLFELLDALECLQNHSNISSR 236

  Fly   475 VFTCGFSIVSGILSHY-NGQNKAPYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEE 529
            ...|...:|...|:.| :.:...|..|:|.|.:|.||.|.|:......:.||||.|
 Frog   237 DLHCWKEMVGKCLAEYASSKCSKPNVQKLKWIVSGRTARQLKHSYYRIAHLPTIPE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 28/79 (35%)
ccng1NP_001006698.1 Cyclin_N 17..149 CDD:365896 44/141 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9962
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2995
Inparanoid 1 1.050 101 1.000 Inparanoid score I4856
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm47991
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.060

Return to query results.
Submit another query.