DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccni

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_012814707.1 Gene:ccni / 448195 XenbaseID:XB-GENE-945654 Length:383 Species:Xenopus tropicalis


Alignment Length:220 Identity:55/220 - (25%)
Similarity:102/220 - (46%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 VLLLP-KESRRE----------VTAGG----------------RDGSAYVLRCLKMWYELPSDVL 294
            :|||| :.:|.|          |..||                ||.....|..||..:.:..:..
 Frog     5 LLLLPGRVARTEDKDWNIHLWRVWMGGPDLASLFLDVGISPEQRDEVILWLAELKYQFRVYPETH 69

  Fly   295 FSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDL-KPIPAEDLVTI-SQCGCTAGDLERMA 357
            ..|:|::||||..:..:||::.|::::.|.||.|.::. :.||...::|. |.|||:..::.||.
 Frog    70 ALAISILDRFLAAVKARPKYLRCIAISCFFLAAKTIEEDERIPVLRVLTQGSSCGCSPAEVLRME 134

  Fly   358 GVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELEN----RLEILM 418
            .:|.:||...:..|  |.:.:|.|::|:..|.:.|:       :.::.:|...::    ..::|.
 Frog   135 RIILDKLNWDLHTA--TPLDFLHIFHAMTLNASPEL-------FDRIPELNPSQHVALLTRQLLQ 190

  Fly   419 CDV--KTTVITPSTLALVLICLHLD 441
            |..  :......|.|||.|:.|.::
 Frog   191 CMAFHQLLQFKGSMLALALLSLEME 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 24/79 (30%)
ccniXP_012814707.1 CYCLIN_CCNI-like 47..145 CDD:410230 30/97 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9962
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.