DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccne2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001002075.1 Gene:ccne2 / 415165 ZFINID:ZDB-GENE-030131-9689 Length:392 Species:Danio rerio


Alignment Length:395 Identity:79/395 - (20%)
Similarity:135/395 - (34%) Gaps:96/395 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 NRNAEMPTDWMRIADEGRYGTPGAAGLEYQKYEQQQQLED-------LAESEAGAV-GGASNNNG 219
            |.||.......:...|.....|.||  :.|.||.|.:..:       |.|:....| ...||.:|
Zfish    14 NENAPQQKSQRKRKGECNRRVPSAA--KKQHYEIQNRCFEGDVSASVLIETPQKEVQQETSNLSG 76

  Fly   220 ESSSSLKKL---EDQLHAL---TSDELY--------------ETLKEYDVLQDKFHTVLLLPKES 264
            ......|.|   ...|..|   :||:::              ..::::..||.|...:||.....
Zfish    77 FKRFRFKNLFVKPSPLPCLSWASSDDVWIKMLNKELKYVHDKSFIQQHSALQPKMRAILLDWLME 141

  Fly   265 RREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRF-LDRMAVKPKHMACMSVASFHLAIK 328
            ..||                  |.|..:..:.|..:.||| |.:..:....:..:.:.|..:|.|
Zfish   142 VSEV------------------YTLHRETFYLAQDIFDRFMLTQKDIGKDQLQLIGITSLFIASK 188

  Fly   329 QLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEI 393
            ..::.|...::...::...|...::.....|:...|...:  .|.|.:|:|:: |:...:|..|.
Zfish   189 IEEIYPPKLQEFAYVTDGACNEEEILAKELVMLKALNWDL--CPETVISWLKL-YSQVDSLKDEA 250

  Fly   394 GGDFFKFYQQ-LIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDF---HIKESYTRGS-- 452
            .....:|.|: .|::.:|   |::.:.|:.:.......||....|....|   |.....|..|  
Zfish   251 NFLIPQFSQETYIQITQL---LDLCILDINSLDYQYGVLAAAAFCHFTSFELVHKVSGLTWDSIS 312

  Fly   453 ------------------PELK---------------HVFEYILFLQQ-YMRIPDRVFTCGFSIV 483
                              ||||               || :|:..|.: :.|..|.|.......|
Zfish   313 NCVRWMNPFMRTVREWPRPELKDFKKVKTDDRHNIQTHV-DYLTMLSEAHDRQQDSVDRMSPMAV 376

  Fly   484 SGILS 488
            :|||:
Zfish   377 AGILT 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 13/78 (17%)
ccne2NP_001002075.1 Cyclin_N 102..229 CDD:278560 21/146 (14%)
Cyclin_C 232..353 CDD:281044 25/125 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.