DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccna1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_997983.2 Gene:ccna1 / 404206 ZFINID:ZDB-GENE-040311-2 Length:391 Species:Danio rerio


Alignment Length:299 Identity:68/299 - (22%)
Similarity:114/299 - (38%) Gaps:59/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 GAAGLEYQKYEQQQQLEDLAESEAGAVGGASNNNGESS---SSLKKLEDQLHALTSDELYETLKE 246
            |.:.:|....:..:....|..||...:..|..:.|..|   ||:..|.|:..|.:.|.|  .:.|
Zfish    74 GDSVIETATVQSVKSTSFLLPSELLVLDDAVQDIGSGSFMDSSMHSLADEEAASSEDVL--CVSE 136

  Fly   247 YDVLQDKFHTVLLLPKESRREVTAGGRDGSAY------VLRCLKM----W-------YELPSDVL 294
            |   .:..|..|       ||.....|....|      :..|:::    |       |:|.|:.|
Zfish   137 Y---AEDIHRYL-------RECEVKYRPKPGYMRKQPDITNCMRVILVDWLVEVGEEYKLCSETL 191

  Fly   295 FSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGV 359
            :.|::.:||||..|:|....:..:..|:..||.|..::.|...::.|.|:....|...|.||...
Zfish   192 YLAVNYLDRFLSCMSVLRGKLQLVGTAAILLAAKYEEVYPPEVDEFVYITDDTYTKKQLLRMEQH 256

  Fly   360 IANKLGVQMGHAPITSVSYLRIYYALFRNL-AKEIGGDFFKFYQQLIKLEELENRLEILMCDVKT 423
            :...|...| .||  ::....:.|:|..:: |:.:.   ...|...:.|.|::..::.|      
Zfish   257 LLRVLAFDM-TAP--TIHQFLMQYSLEEHVCARTLN---LALYLSELSLLEVDPFVQYL------ 309

  Fly   424 TVITPSTLALVLICLHLDFHIKESYTRGS---PELKHVF 459
                ||..|....||       .:||...   ||..:.|
Zfish   310 ----PSKTAAAAYCL-------ANYTLNGALWPENLYAF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 22/77 (29%)
ccna1NP_997983.2 Cyclin_N 140..266 CDD:278560 32/133 (24%)
Cyclin_C <305..384 CDD:281044 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.