DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and LOC394448

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001182327.1 Gene:LOC394448 / 394448 -ID:- Length:390 Species:Xenopus tropicalis


Alignment Length:296 Identity:53/296 - (17%)
Similarity:111/296 - (37%) Gaps:72/296 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 EDLAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESR 265
            |.|.::.:.|:....:.:.|.|.:.:...|.:     .::|..|::.:|            :::.
 Frog    96 EVLCQAFSKALNSVDDIDAEDSFNPQLCTDYV-----KDIYTYLRQLEV------------QQAV 143

  Fly   266 REVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASF 323
            |.....|.:.:..:...|..|       ::|..:.|:.|::::||||....:....:..:.|.|.
 Frog   144 RPRYLHGMEVNERMRAILVDWLIQVHLKFQLLQETLYMAIAIMDRFLQGQPISRSKLQLVGVTSL 208

  Fly   324 HLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRN 388
            .:|.|..::......|.|.|:....:...:..|..:|..:|...:|. |: .:::|       |.
 Frog   209 FIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMMILKELNFDLGR-PL-PLNFL-------RR 264

  Fly   389 LAKEIGGD-----FFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICL---------- 438
            .:|....|     ..|::            :|:.:.|.......||.:|...:||          
 Frog   265 ASKCCSADAGQHTLAKYF------------MELTLLDYDMVHFHPSAIAAAALCLTQKVLNIGTW 317

  Fly   439 --HLDFHIKESYTRGSPE-----LKHVFEYILFLQQ 467
              .|.|     ||..|.:     :||:.:.|:.:.|
 Frog   318 DATLQF-----YTGYSQDDLILPMKHMAKVIVQVNQ 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 16/77 (21%)
LOC394448NP_001182327.1 COG5024 <92..371 CDD:227357 53/296 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.