DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnjl

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001038995.1 Gene:Ccnjl / 380694 MGIID:2685723 Length:387 Species:Mus musculus


Alignment Length:323 Identity:68/323 - (21%)
Similarity:106/323 - (32%) Gaps:121/323 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SDELYETLKEYDVLQDKF--HTVLLLPKESRR-------------EVTAGGRDGSAYVLRCLKMW 286
            :.:::.||:|.::....|  |:.||   :|||             .:....|..:.|:|......
Mouse    11 ASDVHCTLREKELKLPTFRAHSPLL---KSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHFMDQ 72

  Fly   287 YELPSD-----VLFSAMSLVDRFLDRMAVKPK-----HMACMSVASFHLAIKQL----------- 330
            |.:.:.     |..|.:.|..:|.||....||     :...:|..:|.|..|:|           
Mouse    73 YNITTSKQLYTVAVSCLLLASKFEDREDRVPKLEQINNTRILSSQNFSLTKKELLTTELLLLEAF 137

  Fly   331 --DL-KPIPAED-----LVTISQ----CGCTAGDLERMAGVIANKLGVQMGHA-PITSVSYLR-- 380
              || .|.||..     |.:|||    |                       || |.|.:...:  
Mouse   138 SWDLCLPTPAHFLDYYLLASISQKDHHC-----------------------HAWPTTCLRKTKEC 179

  Fly   381 ----IYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHL- 440
                .:|.|...|...|   |:||                     :.:|:..:.:....|||.| 
Mouse   180 LKEYAHYFLEVTLQDHI---FYKF---------------------QPSVVAAACVGASRICLQLS 220

  Fly   441 -----DFHIKESYTRGSPELKHVFEYI-LFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAP 497
                 |.....||:     |:|:...| :.|..|    |.|.....::.|..|:...|.:.||
Mouse   221 PYWTRDLQRVSSYS-----LEHLSTCIEILLVAY----DNVLKDAVAVKSQTLAMVPGSSSAP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 24/110 (22%)
CcnjlNP_001038995.1 CYCLIN 13..>106 CDD:294043 22/95 (23%)
Cyclin_C 144..>246 CDD:281044 30/153 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.