DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CycB

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_726244.1 Gene:CycB / 37618 FlyBaseID:FBgn0000405 Length:530 Species:Drosophila melanogaster


Alignment Length:244 Identity:49/244 - (20%)
Similarity:97/244 - (39%) Gaps:56/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SSSSLKKLED------QLHALTSD---ELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGS 276
            ||..|..:||      :...|.|:   ::|:.|.:.: |:...|          ::..||.::.|
  Fly   233 SSKRLAGIEDIDANDKENLVLVSEYVNDIYDYLYQVE-LEQPIH----------KDHLAGQKEVS 286

  Fly   277 AYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMA-VKPKHMACMSVASFHLAIKQLDLK 333
            ..:...|..|       :.|.::....|::::||:|..:. .|..::..:.|.:..:|.|..:|.
  Fly   287 HKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELF 351

  Fly   334 PIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFF 398
            |....|.|.|:....||..:.:|.                     |:|:.|:..||::.:...|.
  Fly   352 PPAIGDFVFITDDTYTARQIRQME---------------------LQIFKAIDCNLSRPLPIHFL 395

  Fly   399 KFYQQLIKLEELENR-----LEILMCDVKTTVITPSTLAL--VLICLHL 440
            :.|.:....|:..:.     :|:...|.:.....||.:|.  :.:.|||
  Fly   396 RRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEIAAASLFLSLHL 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/78 (22%)
CycBNP_726244.1 Cyclin_N 260..387 CDD:278560 30/158 (19%)
Cyclin_C 389..515 CDD:281044 11/56 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.