DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccne2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001102126.1 Gene:Ccne2 / 362485 RGDID:1307783 Length:405 Species:Rattus norvegicus


Alignment Length:207 Identity:41/207 - (19%)
Similarity:87/207 - (42%) Gaps:20/207 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SDELYETL--KEYDVLQDKFHTVLLLPKESR-REVTAGGRDGSAYVLRCLKMWYELPSDVLFSAM 298
            |.|:::.:  ||...:.||...||....|.: |.:...      ::|...:: |.|..:..:.|.
  Rat   111 SQEVWQNMLQKESRYVHDKHFEVLHSDLEPQMRSILLD------WLLEVCEV-YTLHRETFYLAQ 168

  Fly   299 SLVDRF-LDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIAN 362
            ...||| |.:..|....:..:.:.|..:|.|..::.....::...::...|:..|:.:|...|..
  Rat   169 DFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILK 233

  Fly   363 KLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQ--LIKLEELENRLEILMCDVKTTV 425
            .|..::  .|:|.:|:|.::..:  :..|:|.......|.|  .|::.:|   |::.:..:.:..
  Rat   234 ALKWEL--CPVTVISWLNLFLQV--DAVKDIPKVLLPQYSQETFIQIAQL---LDLCILAIDSLE 291

  Fly   426 ITPSTLALVLIC 437
            .....||...:|
  Rat   292 FQYRILAAAALC 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/78 (19%)
Ccne2NP_001102126.1 CYCLIN_SF 101..237 CDD:424085 27/132 (20%)
CYCLIN_SF 241..329 CDD:424085 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.