DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and AgaP_AGAP012299

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_551892.3 Gene:AgaP_AGAP012299 / 3291547 VectorBaseID:AGAP012299 Length:323 Species:Anopheles gambiae


Alignment Length:227 Identity:46/227 - (20%)
Similarity:89/227 - (39%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 HALTSDELYET---LKEYDVLQ-DKFHTVLLLPKESRREVTAGGRDGSAYVL--RCLKMWYELPS 291
            |.:|.|.:...   |:.|.:.. :.|..|....|.:.|::.      :.::|  :|.:..:.|  
Mosquito    33 HMITDDRVLPNLIRLERYTIPPCNYFVAVQQDIKPAMRKIV------TTWMLEQKCEEQTFPL-- 89

  Fly   292 DVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERM 356
                 |::..||||..:|:...|:..:...:..||.|....:|:..:.|...:....:...:...
Mosquito    90 -----AVNFFDRFLCALAIDRYHLQLLGCCTLLLASKIRQCQPLTVDVLSAYTDHAVSPDQIRNW 149

  Fly   357 AGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDV 421
            ..::.:||  :.....:|:..|  :.:.|.|          .|:.....:|.|..:.| |.:|:.
Mosquito   150 ELLLISKL--EWNINAVTAYDY--VDHILER----------VKWGSDDARLREHAHTL-IHVCNT 199

  Fly   422 KTTV--ITPSTLALVLICLHLDFHIKESYTRG 451
            :|..  :.||.||:..|.         |.|||
Mosquito   200 ETIFMQVEPSLLAVSCIA---------SATRG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/77 (18%)
AgaP_AGAP012299XP_551892.3 Cyclin_N 43..162 CDD:278560 23/133 (17%)
Cyclin_C 164..>259 CDD:281044 20/81 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.