DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnb3

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_038956227.1 Gene:Ccnb3 / 317389 RGDID:1564367 Length:1405 Species:Rattus norvegicus


Alignment Length:466 Identity:84/466 - (18%)
Similarity:153/466 - (32%) Gaps:159/466 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 EYQKYEQQ----------------QQLEDLAESEAGAVGGAS------NNNG--------ESSSS 224
            :|::::.:                :::.||.|.:.|.|...|      |.:.        :..||
  Rat   174 DYKEFDSELMTSRRKDKPEEATIIEEMTDLKEPDLGKVTLTSSPLYLKNKHAVQEEKHAIQGKSS 238

  Fly   225 LKKLEDQLHALT-----------------SDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGG 272
            .||....:..:|                 :.||...|:|...||:|::|                
  Rat   239 FKKKSLAMKVVTTKENSPVKKPHFRKKKPTTELKSLLQEQSSLQEKYNT---------------- 287

  Fly   273 RDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLA----------- 326
             .|.|.:|:       .|..:..:..:.||...:.:.:|.||....::.:..|:           
  Rat   288 -QGDASILK-------KPRVLQKNINNKVDTLTEPVTLKRKHSTNEAIHTKKLSSSKNNHDTQGK 344

  Fly   327 ---IKQLDLKPIPAEDLVTISQCGCTAGDLERMAG--VIANKLGVQMGHAPITSVSYLRIYYALF 386
               ::.|.::|:..|:....|:...|........|  |:.:|      |:|...||..:...||.
  Rat   345 GTNLRPLGVQPVTHENEPLSSKKSTTKKKDSHFHGPSVLPDK------HSPQMKVSTAKNSLALQ 403

  Fly   387 RNLAKEIGGDF-----------------FKFYQQLIKLEELENR-LEILMCDVKTTVITPSTLAL 433
            ....:|:...|                 .|....|.|.::|..| .....|.|:.||.:.|    
  Rat   404 NPTTEEMMLHFPVAPVLKMGQNMEEAPCLKKPSPLRKQQQLPKRSRSFSKCAVQETVTSKS---- 464

  Fly   434 VLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFT----------C-----GFSIV 483
                  |.|  |:|.|:..|..:..|.    ||:....|.::..          |     .|.:.
  Rat   465 ------LSF--KKSNTKKDPSFQGPFA----LQKKRNSPGKLSKQKKRYVPPKHCMEKDSHFQLD 517

  Fly   484 SGILSHYNGQNKAPYKQRLVWKLSSRT----LRVLRPINRFSSDLPTIEEGIPNALDDGLRSRTE 544
            |.....:..:..|...:.|:.::...|    .|:..|:     .|||:        ..|.:|.|:
  Rat   518 SAFKKQHIREEPASTHKPLILEMQQTTKGTEFRLRNPL-----VLPTV--------TSGTKSLTK 569

  Fly   545 SISSEEEEDWP 555
            ...|.::|:.|
  Rat   570 EPPSFKKENTP 580

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/93 (16%)
Ccnb3XP_038956227.1 CYCLIN_SF 1133..1270 CDD:424085
CYCLIN_SF 1274..1388 CDD:424085
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.