DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnjl

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001032862.2 Gene:Ccnjl / 303059 RGDID:1561384 Length:387 Species:Rattus norvegicus


Alignment Length:319 Identity:65/319 - (20%)
Similarity:103/319 - (32%) Gaps:113/319 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SDELYETLKEYDVLQDKF--HTVLLLPKESRR-------------EVTAGGRDGSAYVLRCLKMW 286
            :.:::.||:|.::....|  |:.||   :|||             .:....|..:.|:|......
  Rat    11 ASDVHCTLREKELKLPTFRAHSPLL---KSRRFFVDILTLLSRHCHLCPSARHLAIYLLDHFMDQ 72

  Fly   287 YELPSD-----VLFSAMSLVDRFLDRMAVKPK-----HMACMSVASFHLAIKQL----------- 330
            |.:.:.     |..|.:.|..:|.||....||     ....:|..:|.|..|:|           
  Rat    73 YNVTTSKQLYTVAVSCLLLASKFEDREDRVPKLDQINSTRILSSHNFSLTKKELLTTELLLLEAF 137

  Fly   331 --DL-KPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHA----PITSVSYLR------IY 382
              || .|.||..|           |...:|.:      .|..|.    |.|.:...:      .:
  Rat   138 SWDLCLPTPAHFL-----------DYYLLASI------SQKDHHCHTWPTTCLRKTKECLKEYAH 185

  Fly   383 YALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKES 447
            |.|...|...|   |:||                     :.:|:..:.:....|||.|..:    
  Rat   186 YFLEVTLQDHI---FYKF---------------------QPSVVAAACVGASRICLQLSPY---- 222

  Fly   448 YTRGSPELKHVFEYIL---------FLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAP 497
            :||   :|:.|..|.|         .|..|    |.|.....::.|..|:.....:.||
  Rat   223 WTR---DLQRVSNYSLEHLSTCIEILLVAY----DNVLKDAVAVKSQALAMVPSSSSAP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 22/101 (22%)
CcnjlNP_001032862.2 CYCLIN_CCNJ-like_rpt1 32..120 CDD:410231 18/90 (20%)
CYCLIN_CCNJ-like_rpt2 144..245 CDD:410232 28/148 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.