DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccng2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001099195.1 Gene:Ccng2 / 29157 RGDID:1305002 Length:344 Species:Rattus norvegicus


Alignment Length:328 Identity:96/328 - (29%)
Similarity:168/328 - (51%) Gaps:45/328 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 QDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHM 315
            ::|..|::....|:...:.:..|:.....||.|..::...::....|::::||||..|.|||||:
  Rat    34 REKGLTLMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNILDRFLALMKVKPKHL 98

  Fly   316 ACMSVASF----HLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSV 376
            :|:.|..|    .||.::.|:.  |..|::.||||.|||.|::||..:|:.||..::  ...|::
  Rat    99 SCIGVCCFLLAARLAEEECDIP--PTHDVIRISQCKCTASDIKRMEKIISEKLHYEL--EATTAL 159

  Fly   377 SYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLD 441
            ::|.:|:|:....:.|        .::::.|::||.:|:...|.:..:...||.|||.|:.|.::
  Rat   160 NFLHLYHAIVFCHSPE--------RKEVLSLDKLEAQLKACNCRLVFSKAKPSVLALCLLNLEIE 216

  Fly   442 FHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKA-PYKQRLVWK 505
                   |..|.||   .|.:|.::::::|.|..|.....:||..|:.|:..:.. |..::|||.
  Rat   217 -------TIKSVEL---LEILLLVKKHLKISDTEFFYWRELVSKCLAEYSSPHCCKPDLKKLVWI 271

  Fly   506 LSSRTLRVLRPINRFSS--DLPTIEEGIPNALDDGLRSRTESISSEE-----EEDWPTSPIIPIF 563
            :|.||.:.|.  |.:.|  :||||.||       |....:||..|.|     ||...:||  |..
  Rat   272 VSRRTAQSLH--NSYYSVPELPTIPEG-------GCFDGSESEDSGEDMSCGEESLSSSP--PSD 325

  Fly   564 EQC 566
            ::|
  Rat   326 QEC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 31/81 (38%)
Ccng2NP_001099195.1 CYCLIN_CCNG2 55..150 CDD:410287 35/96 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4793
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm44938
orthoMCL 1 0.900 - - OOG6_110423
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.820

Return to query results.
Submit another query.