DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccni

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001099468.1 Gene:Ccni / 289500 RGDID:1309209 Length:377 Species:Rattus norvegicus


Alignment Length:363 Identity:81/363 - (22%)
Similarity:148/363 - (40%) Gaps:79/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 LPK-ESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASF 323
            :|| .:.:.|:...||.....|..||..:.|..:....|.||:||||..:...||::.|::::.|
  Rat    31 VPKIPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLNCIAISCF 95

  Fly   324 HLAIKQLDL-KPIPA-EDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALF 386
            .||.|.::. :.||. :.|...|.|||::.::.||..:|.:||...:..|  |.:.:|.|::|:.
  Rat    96 FLAAKTVEEDEKIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTA--TPLDFLHIFHAIA 158

  Fly   387 RNLAKEIGGDFFKFYQQLIKLEEL----------ENRLEILMCDVKTTVITPSTLALVLICLHLD 441
            .:...::          |..|..|          :..|..:.|: :......|.|||.::.|.::
  Rat   159 VSTRPQL----------LFSLPRLSPSQHLAVLTKQLLHCMACN-QLLQFKGSMLALAMVSLEME 212

  Fly   442 ----------FHIKESYTRGSPELKHVFEYILF----LQQ---------YMRIPDRVFTC---GF 480
                      ..:.:.....|.:|.|..|.:.:    ||.         |..:...:.||   .|
  Rat   213 KLIPDWLPLTIELLQKAQMDSSQLIHCRELVAYHLSALQSSLPLNSVYVYRPLKHTLVTCDKGAF 277

  Fly   481 ----SIVSG-ILSHYNGQNKAPYKQRLVWKLSSRTLRVLRPIN--RFSSDLPTIEEGIPNALDDG 538
                |.:|| ..|..|.:.:.|.:....:.|.      |..::  :.:|....:||...:.|.||
  Rat   278 KLHPSSISGPDFSKDNSKPEVPVRGPAAFHLH------LPAVSGCKHTSAKRKVEEMEVDDLYDG 336

  Fly   539 LR------SRTESISS--------EEEEDWPTSPIIPI 562
            ::      |.:|::.|        :|....|..|:.|:
  Rat   337 IKRLYNEDSGSENVGSVCGTDLSRQEGHASPCPPLQPV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 26/79 (33%)
CcniNP_001099468.1 Cyclin_N 38..142 CDD:278560 33/103 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44938
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.