DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnb1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_758505.2 Gene:Ccnb1 / 268697 MGIID:88302 Length:430 Species:Mus musculus


Alignment Length:304 Identity:65/304 - (21%)
Similarity:116/304 - (38%) Gaps:62/304 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSD---ELYETLKEYDVLQDKFHTVLLLPKES 264
            ||.|:..|..||..|                 |.|:   ::|..|::.:..|.      :.||..
Mouse   148 LAVSDVDADDGADPN-----------------LCSEYVKDIYAYLRQLEEEQS------VRPKYL 189

  Fly   265 R-REVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIK 328
            : ||||...|......|..::|.:.|..:.::..:|::|||:....|..|.:..:.|.:..:|.|
Mouse   190 QGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQNSCVPKKMLQLVGVTAMFIASK 254

  Fly   329 QLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEI 393
            ..::.|....|...::....|...:.:|...|...|...:|. |: .:.:||        .|.::
Mouse   255 YEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGR-PL-PLHFLR--------RASKV 309

  Fly   394 GGDFFKFYQQLIKLEE---LENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPEL 455
            |.         :.:|:   .:..:|:.|.|.......||.:|....||.|.......:|   |.|
Mouse   310 GE---------VDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKILDNGEWT---PTL 362

  Fly   456 KHVFEY----ILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNK 495
            :|...|    :|.:.|::.....:..|      |:..|...:||
Mouse   363 QHYLSYSEDSLLPVMQHLAKNVVMVNC------GLTKHMTVKNK 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/77 (19%)
Ccnb1NP_758505.2 Interaction with CDK2. /evidence=ECO:0000250 166..174 1/7 (14%)
Cyclin_N 170..295 CDD:278560 28/130 (22%)
Interaction with CDK2. /evidence=ECO:0000250 255..258 0/2 (0%)
Cyclin_C 297..415 CDD:281044 27/131 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.