DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccng2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_998337.1 Gene:ccng2 / 266794 ZFINID:ZDB-GENE-021016-1 Length:330 Species:Danio rerio


Alignment Length:342 Identity:93/342 - (27%)
Similarity:159/342 - (46%) Gaps:42/342 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 ELYETLKEYDVLQDKFHTVLLLPK-------ESRRE----VTAGGRDGSAYVLRCLKMWYELPSD 292
            |.::.:||.....|.  .|..|||       ||.:|    |:|..||.....|..|..::...:.
Zfish     2 EAFKLMKELKSNLDL--EVQYLPKETGLRLIESTQENSNGVSAKCRDARVEDLWSLTNFFGYSTQ 64

  Fly   293 VLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIK--QLDLKPIPAEDLVTISQCGCTAGDLER 355
            ....|::|:||||..|.|:||::||:|:...|:|::  :.:.....:.:|:.||||..|..||.|
Zfish    65 TFVLAVNLLDRFLAMMKVQPKYLACISIGCLHIAVRVTEGECNVSSSHELIRISQCKFTVSDLSR 129

  Fly   356 MAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCD 420
            |..:|:.||..|.  ..:|::::|.:|:|:..:....        .:.::.|::||.:|:..:|.
Zfish   130 MEKIISEKLNFQF--KAVTALTFLHLYHAIALSHTSN--------RKDVLNLDKLEAQLKACLCR 184

  Fly   421 VKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSG 485
            :..:...||.|||.|:.|.::       ...|.:|..:...|   |.:::|..........:|..
Zfish   185 IVFSKAKPSVLALSLLMLEIE-------ALQSADLLEIAHRI---QTHLKISKADLGRWRGLVGQ 239

  Fly   486 ILSHYNGQNKA-PYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEEGIPNALD-----DGLRSRTE 544
            .:..|:....| |..::|||.:|.||.:.|........:||||.||:.:..:     :.|.|..|
Zfish   240 CIRDYSSPECAKPDHKKLVWIVSRRTAQNLHSSYCSIPELPTIPEGVWDESESEDSSEDLSSGEE 304

  Fly   545 SISSEEEEDWPTSPIIP 561
            |:||....| ...|..|
Zfish   305 SLSSSLGSD-AEGPYFP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 27/79 (34%)
ccng2NP_998337.1 CYCLIN <59..140 CDD:294043 28/80 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10232
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4992
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm26251
orthoMCL 1 0.900 - - OOG6_110423
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.820

Return to query results.
Submit another query.