DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccne1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001094291.1 Gene:Ccne1 / 25729 RGDID:2294 Length:411 Species:Rattus norvegicus


Alignment Length:255 Identity:43/255 - (16%)
Similarity:94/255 - (36%) Gaps:71/255 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVD 302
            ||.:  |:.:.:||.:...|||                 .:::...:: |:|..:..:.|....|
  Rat   131 DEHF--LQRHPLLQARMRAVLL-----------------DWLMEVCEV-YKLHRETFYLAQDFFD 175

  Fly   303 RFL-DRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGV 366
            |:: .:..:....:..:.:::..:|.|..::.|........::...|:..::..|..::...|..
  Rat   176 RYMASQQNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMMKALKW 240

  Fly   367 QMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELE-------------------- 411
            ::  :|:|.||:|.:|..:  ....:.|......|.|.:.::..|                    
  Rat   241 RL--SPLTIVSWLNVYVQV--AYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFPYGVLA 301

  Fly   412 -------NRLEILM-------CDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKH 457
                   :.||::.       ||::..|......|:|         |:|   .||.:|||
  Rat   302 ASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMV---------IRE---MGSSKLKH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 10/78 (13%)
Ccne1NP_001094291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44
CYCLIN_SF 104..240 CDD:424085 19/128 (15%)
CYCLIN_CCNE1_rpt2 244..357 CDD:410284 24/120 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.