DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and cig2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_593889.1 Gene:cig2 / 2543481 PomBaseID:SPAPB2B4.03 Length:411 Species:Schizosaccharomyces pombe


Alignment Length:216 Identity:43/216 - (19%)
Similarity:90/216 - (41%) Gaps:38/216 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 SNNNGESSSSLKK-----LEDQL--HALTSD----ELYETLKEYDVLQDKFHTVLLLPK--ESRR 266
            |.|...|..:|:|     ::|.|  :.|.::    |::|.:::.|:      ..|..||  :.::
pombe   104 SKNADPSVETLQKDRVSNVDDHLSSNPLMAEEYAPEIFEYIRKLDL------KCLPNPKYMDQQK 162

  Fly   267 EVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFH 324
            |:|...|:       .|..|       :.|..:.|:.|::::||||.|.:..........:.:..
pombe   163 ELTWKMRE-------ILNEWLVEIHSNFCLMPETLYLAVNIIDRFLSRRSCSLSKFQLTGITALL 220

  Fly   325 LAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGH-APIT---SVSYLRIYYAL 385
            :|.|..::.....::.|.::....|..|:......:.|.|...:.: :|:.   .:|....|.|.
pombe   221 IASKYEEVMCPSIQNFVYMTDGAFTVEDVCVAERYMLNVLNFDLSYPSPLNFLRKISQAEGYDAQ 285

  Fly   386 FRNLAKEIGGDFFKFYQQLIK 406
            .|.|.|.: .:.:.|...|::
pombe   286 TRTLGKYL-TEIYLFDHDLLR 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/77 (18%)
cig2NP_593889.1 COG5024 1..399 CDD:227357 43/216 (20%)
Cyclin_N 139..265 CDD:278560 26/138 (19%)
Cyclin_C 267..382 CDD:281044 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.