DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and cdc13

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001342891.1 Gene:cdc13 / 2540880 PomBaseID:SPBC582.03 Length:482 Species:Schizosaccharomyces pombe


Alignment Length:332 Identity:62/332 - (18%)
Similarity:127/332 - (38%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 ELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLR-CLKMW-------YELPSDVLF 295
            :::|.|.|.::......|.:...||            .|:.:| .|..|       :.|..:.||
pombe   206 DIFEYLNELEIETMPSPTYMDRQKE------------LAWKMRGILTDWLIEVHSRFRLLPETLF 258

  Fly   296 SAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVI 360
            .|::::||||.........:..:.:|:..:|.|..::.....::.|.::..|....::.:....|
pombe   259 LAVNIIDRFLSLRVCSLNKLQLVGIAALFIASKYEEVMCPSVQNFVYMADGGYDEEEILQAERYI 323

  Fly   361 ANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTV 425
            ...|...:.:.  ..:::|       |.::|   .||:....:.:    .:..:||.:.|.|...
pombe   324 LRVLEFNLAYP--NPMNFL-------RRISK---ADFYDIQTRTV----AKYLVEIGLLDHKLLP 372

  Fly   426 ITPSTLALVLICLHLDFHIKESYTRG--SPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILS 488
            ..||..     |....:..:|...||  :..|.|...|    ::|..|         |:|..:::
pombe   373 YPPSQQ-----CAAAMYLAREMLGRGPWNRNLVHYSGY----EEYQLI---------SVVKKMIN 419

  Fly   489 HYNG--QNKAPYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEEGIP---NALDDGLRSRTESISS 548
            :...  |::|.:|:....|....:|.|...|.:.|         ||   :|.:|....:.:.|..
pombe   420 YLQKPVQHEAFFKKYASKKFMKASLFVRDWIKKNS---------IPLGDDADEDYTFHKQKRIQH 475

  Fly   549 E-EEEDW 554
            : ::|:|
pombe   476 DMKDEEW 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/77 (18%)
cdc13NP_001342891.1 COG5024 5..454 CDD:227357 54/293 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.