DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and puc1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001342772.1 Gene:puc1 / 2540654 PomBaseID:SPBC19F5.01c Length:359 Species:Schizosaccharomyces pombe


Alignment Length:161 Identity:42/161 - (26%)
Similarity:64/161 - (39%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 LAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPK----- 262
            |....|..|...|..:.|||:.|...:..|  ||...:...|.||.  :|..|.::...|     
pombe    54 LKNETAFVVDSVSTLSAESSALLYNTQSSL--LTGLSMNGYLGEYQ--EDIIHHLITREKNFLLN 114

  Fly   263 ----ESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHM-----ACM 318
                ..:.|:....|......:..:...::|..|.|..::||:|.::.|..|..||:     .|:
pombe   115 VHLSNQQPELRWSMRPALVNFIVEIHNGFDLSIDTLPLSISLMDSYVSRRVVYCKHIQLVACVCL 179

  Fly   319 SVAS-FH--------LAIKQLDLKPIPAEDL 340
            .:|| ||        |...:|..|.|.||||
pombe   180 WIASKFHETEDRVPLLQELKLACKNIYAEDL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 23/68 (34%)
puc1NP_001342772.1 COG5024 3..359 CDD:227357 42/161 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.