DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccng1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_037055.1 Gene:Ccng1 / 25405 RGDID:2295 Length:294 Species:Rattus norvegicus


Alignment Length:315 Identity:93/315 - (29%)
Similarity:152/315 - (48%) Gaps:42/315 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LHALTSD------ELYETLKEYDVLQDKFHTVLLLPKESRRE----VTAGGRDGSAYVLRCLKMW 286
            :..||:|      :|...|::....|.|...:.|:  ||..:    :||..||.....|..|..:
  Rat     2 IEVLTTDSQKLLHQLNTLLEQESRCQPKVCGLKLI--ESAHDNGLRMTARLRDFEVKDLLSLTQF 64

  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQL-DLKPIP-AEDLVTISQCGCT 349
            :...::....|::|:||||.:|.|:.||:.|:.::.|:||:|.: :.:.:| |.||:.|||...|
  Rat    65 FGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFT 129

  Fly   350 AGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFR-NLAKEIGGDFFKFYQQLIKLEELENR 413
            ..||.||..::..|:..::  ...|:..:|::||:|.| .|..|...|        :..|.||.:
  Rat   130 VSDLMRMEKIVLEKVCWKV--KATTAFQFLQLYYSLIRETLPFERRND--------LNFERLEAQ 184

  Fly   414 LEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHV--FEYILFLQQYMRIPDRVF 476
            |:...|.:..:...||.|||.:|.|.:.            .||:|  .|.:..:|::.:|..|..
  Rat   185 LKACHCRIIFSKAKPSVLALAIIALEIQ------------ALKYVELTEGVECIQKHSKISGRDL 237

  Fly   477 TCGFSIVSGILSHYNGQNKA--PYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEE 529
            |....:||..|:.|: .||.  |..|:|.|.:|.||.|.|:......:.||||.|
  Rat   238 TFWQELVSKCLTEYS-SNKCSKPNGQKLKWIVSGRTARQLKHSYYRITHLPTIPE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 28/79 (35%)
Ccng1NP_037055.1 CYCLIN_CCNG1 50..147 CDD:410286 32/96 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9562
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2995
Inparanoid 1 1.050 110 1.000 Inparanoid score I4793
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm44938
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.