DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccno

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001074531.1 Gene:Ccno / 218630 MGIID:2145534 Length:352 Species:Mus musculus


Alignment Length:362 Identity:77/362 - (21%)
Similarity:130/362 - (35%) Gaps:120/362 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 DLAESEAGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEY--------DVLQDKFHTVL 258
            ||.||.:.:..||.:....::.....|.:....||:.:| :|.:||        ...::.||   
Mouse    59 DLFESPSSSSDGADSPAVSAARDCSSLLNPAQPLTALDL-QTFREYGQSCYDFRKAQENLFH--- 119

  Fly   259 LLPKES---RREVTAGGRDGSAYVLRC-LKMW-------YELPSDVLFSAMSLVDRFLDRMAVKP 312
              |:||   :.:|||..        || |..|       :.|..:.|...::.:||||....|..
Mouse   120 --PRESLARQPQVTAES--------RCKLLSWLLQVHRQFGLSFESLCLTVNTLDRFLLTTPVAA 174

  Fly   313 KHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLER-----MAGVIANKLGVQMGHAP 372
            .....:.|....:|.||:::.|...:.|:.:  ||   |...|     :..::.:||...:| ||
Mouse   175 DCFQLLGVTCLLIACKQVEVHPPRLKQLLAL--CG---GAFSRQQLCNLECIVLHKLHFSLG-AP 233

  Fly   373 ITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENR------LEILMCDVKTTVITPSTL 431
              ::::...::..:|   .|.|        |....|.||.:      .|:.:.|...|..|||.:
Mouse   234 --TINFFLEHFTQWR---MEAG--------QAEVTEALEAQTLARGVAELSLTDYAFTTYTPSLM 285

  Fly   432 ALVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYN----- 491
            |:                                            |..::..|:|.|.:     
Mouse   286 AI--------------------------------------------CCLALADGLLQHQHEMDLR 306

  Fly   492 -GQNKAPYKQRLVWKLSSRTLRVLRPINRFSSDLPTI 527
             |::.....|..:.|     |:.|..||  ||.||.|
Mouse   307 LGEHPEATLQDCLGK-----LQTLVSIN--SSSLPRI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/82 (22%)
CcnoNP_001074531.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40
Cyclin_N 108..231 CDD:278560 31/140 (22%)
Cyclin_C 233..>301 CDD:281044 19/124 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.