DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccna2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_694481.1 Gene:ccna2 / 192295 ZFINID:ZDB-GENE-020418-1 Length:428 Species:Danio rerio


Alignment Length:155 Identity:35/155 - (22%)
Similarity:65/155 - (41%) Gaps:21/155 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAG 351
            |:|.::.|:.|::.:||||..|:|....:..:..|:..||.|..::.|....:.|.|:....|..
Zfish   221 YKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKK 285

  Fly   352 DLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELE---NR 413
            .:.||..::...|...:. ||  :::.....|.|.:.::.              |:|.|.   ..
Zfish   286 QVLRMEHLVLTVLSFDLA-AP--TINQFLTQYFLHQPVSS--------------KVESLSMFLGE 333

  Fly   414 LEILMCDVKTTVITPSTLALVLICL 438
            |.::.||.....: ||.:|.....|
Zfish   334 LSLIDCDPFLKYL-PSQMAAAAFIL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 20/77 (26%)
ccna2NP_694481.1 Cyclin_N2 33..157 CDD:293109
Cyclin_N 177..303 CDD:278560 21/81 (26%)
Cyclin_C 305..422 CDD:281044 13/70 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.