powered by:
Protein Alignment CycG and T24A6.1
DIOPT Version :9
Sequence 1: | NP_001263146.1 |
Gene: | CycG / 43724 |
FlyBaseID: | FBgn0039858 |
Length: | 566 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001309661.1 |
Gene: | T24A6.1 / 188821 |
WormBaseID: | WBGene00020744 |
Length: | 91 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 17/69 - (24%) |
Similarity: | 29/69 - (42%) |
Gaps: | 12/69 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 284 KMWYELPSDVLFSAMSLVDRFL----DRMAVKPKHM---ACMS-----VASFHLAIKQLDLKPIP 336
|:...||::.....:.|::||| :.:..||... :|.: .......:|.|:|.||.
Worm 15 KIRENLPNNPTVPDILLMERFLIGKFEFVVAKPTPSWLGSCFAKRINLTKKMRNDVKLLELSPID 79
Fly 337 AEDL 340
|..|
Worm 80 AHFL 83
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5024 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.