DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and T24A6.1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001309661.1 Gene:T24A6.1 / 188821 WormBaseID:WBGene00020744 Length:91 Species:Caenorhabditis elegans


Alignment Length:69 Identity:17/69 - (24%)
Similarity:29/69 - (42%) Gaps:12/69 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 KMWYELPSDVLFSAMSLVDRFL----DRMAVKPKHM---ACMS-----VASFHLAIKQLDLKPIP 336
            |:...||::.....:.|::|||    :.:..||...   :|.:     .......:|.|:|.||.
 Worm    15 KIRENLPNNPTVPDILLMERFLIGKFEFVVAKPTPSWLGSCFAKRINLTKKMRNDVKLLELSPID 79

  Fly   337 AEDL 340
            |..|
 Worm    80 AHFL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 16/66 (24%)
T24A6.1NP_001309661.1 COG5024 <2..88 CDD:227357 17/69 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.