DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccng1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_021336635.1 Gene:ccng1 / 171473 ZFINID:ZDB-GENE-020322-1 Length:313 Species:Danio rerio


Alignment Length:313 Identity:88/313 - (28%)
Similarity:149/313 - (47%) Gaps:38/313 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 ELYETLKEYDVLQDKFHTVLLLPKESRRE------------------VTAGGRDGSAYVLRCLKM 285
            |:.:.:.|...|........||.:|||.:                  :|...||.....|..|..
Zfish    14 EMIDQVTETGALPFTVQLKSLLDQESRYQPKLCGLRVIESAQDNGLRMTVKLRDYQVRELLSLTR 78

  Fly   286 WYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIK-QLDLKPIP-AEDLVTISQCGC 348
            ::...::....|::|:||||..|.::|||::|:.:..|::|:| ..:.|.:| |.||:.|||...
Zfish    79 FFGFCAETFSFAVNLLDRFLAVMKIQPKHLSCVGLCCFYIAVKTSEEEKNVPLASDLIRISQNRF 143

  Fly   349 TAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENR 413
            |..|:.||..:|..||..:: .|| |::.:||.:::   ::.:::..:    .::::.:|.||.:
Zfish   144 TVHDMMRMEKIILEKLNWKV-KAP-TALHFLRFFHS---HIQEKVDTE----SKKILNIERLEAQ 199

  Fly   414 LEILMCDVKTTVITPSTLALVLICLHL-DFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFT 477
            |:...|....|.:.||.|||.|:.|.: |.|..|..    |.||...:   .|||.:.:......
Zfish   200 LKACHCSFTFTKLKPSLLALSLLALEIEDQHEYEPV----PSLKEALD---GLQQSLNVKVGDLV 257

  Fly   478 CGFSIVSGILSHYNGQN-KAPYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEE 529
            |...:|:..|..|:... :.|..|||.|.:|.||.|.|:......:.||||.|
Zfish   258 CVRELVAKCLVEYSSTKCQKPNGQRLRWMISGRTARQLKHSYYKIAHLPTIPE 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 28/79 (35%)
ccng1XP_021336635.1 Cyclin_N 31..163 CDD:306612 39/131 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10232
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2995
Inparanoid 1 1.050 100 1.000 Inparanoid score I4992
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm26251
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.920

Return to query results.
Submit another query.