DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and AgaP_AGAP004963

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_315060.4 Gene:AgaP_AGAP004963 / 1275774 VectorBaseID:AGAP004963 Length:464 Species:Anopheles gambiae


Alignment Length:402 Identity:77/402 - (19%)
Similarity:147/402 - (36%) Gaps:116/402 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 QKYEQQQQLEDLAESEAGAVGGASNNNGESSS------SLKKLEDQLHALTSDELYETLKEYDVL 250
            ::.:.|..|..||:....|...::.::|.|||      |:.|..:::.| .|.:|.|.::..|. 
Mosquito   112 KREDSQLSLRTLAKQNRKAQPKSAPSSGTSSSDEHEIVSISKKPEKVEA-HSQKLLENIENIDA- 174

  Fly   251 QDKFHTVL-----------LLPKESR-------------REVTAGGRDGSAYVLRCLKM-W---- 286
            .|.::.:|           |...|||             :|:|        :.:|.:.: |    
Mosquito   175 NDGWNPMLVAEYVNDIYNYLNELESRPGYALCENFLDGHKEIT--------HKMRTILIDWINEV 231

  Fly   287 ---YELPSDVLFSAMSLVDRFLDRMAVKP-KHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCG 347
               ::|..|.....:||:||:|..|...| |.:..:.|.:..:|.|..:|.|...:|.|.|:.  
Mosquito   232 HYQFKLDIDTYHMTVSLIDRYLQTMKTVPKKKLQLVGVTAMFIASKYEELFPPEIQDFVYITD-- 294

  Fly   348 CTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELEN 412
                |..:...::      :|....:.::.:         ||.|.:...|.:.:.:..|..::.:
Mosquito   295 ----DTYQKYQIL------EMEKEMVRTLDF---------NLGKPLPTHFLRRFSKAAKASDVNH 340

  Fly   413 RL-----EILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIP 472
            .|     |:...|..|....||.:|..  .|::..::....:.|......:. :...|:.|    
Mosquito   341 VLAKYLIELASVDYSTAHYKPSEIAAA--ALYISLYLFPLTSNGGNGTSAII-WTKTLEHY---- 398

  Fly   473 DRVFTCGFSIVSGILSHYNGQNKAPYKQRLV-----------------W--KLSSRTLRVLRPIN 518
                           :|||.:..||..|||.                 |  ..||:.|::.....
Mosquito   399 ---------------THYNVKYLAPIVQRLANVIKAVPKMMEKKQKSCWLKYSSSKFLKISTHSK 448

  Fly   519 RFSSDLPTIEEG 530
            ...:::.|:.||
Mosquito   449 LKGTEMDTLAEG 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 19/78 (24%)
AgaP_AGAP004963XP_315060.4 Cyclin_N 189..318 CDD:278560 29/157 (18%)
Cyclin_C 320..447 CDD:281044 25/148 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.