DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccng2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_031661.3 Gene:Ccng2 / 12452 MGIID:1095734 Length:344 Species:Mus musculus


Alignment Length:335 Identity:97/335 - (28%)
Similarity:169/335 - (50%) Gaps:43/335 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 LKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYV--LRCLKMWYELPSDVLFSAMSLVDRFLD 306
            |::....|.:...::|:......:.|...|..:|.|  ||.|..::...::....|::::||||.
Mouse    25 LEQEQRYQPREKGLILMEATPENDNTLCSRLRNAKVEDLRSLTNFFGSGTETFVLAVNILDRFLA 89

  Fly   307 RMAVKPKHMACMSVASFHLAIKQLDLK---PIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQM 368
            .|.|||||::|:.|..|.||.:..:.:   | |..|::.||||.|||.|::||..:|:.||..::
Mouse    90 LMKVKPKHLSCIGVCCFLLAARLAEEEGDVP-PTHDVIRISQCKCTASDIKRMEKIISEKLHYEL 153

  Fly   369 GHAPITSVSYLRIYYAL-FRNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLA 432
              ...|::::|.:|:|: |.:.::.         ::::.|::||.:|:...|.|..:...||.||
Mouse   154 --EATTALNFLHLYHAIVFCHTSER---------KEILSLDKLEAQLKACNCRVVFSKARPSVLA 207

  Fly   433 LVLICLHLDFHIKESYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKA- 496
            |.|:.|.::       |..|.||   .|.:|.:::::::.|..|.....:||..|:.|:..... 
Mouse   208 LCLLNLEIE-------TIKSVEL---LEILLLVKKHLKLSDTEFFYWRELVSKCLAEYSSPRCCK 262

  Fly   497 PYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEEGIPNALDDGLRSRTESISSEE-----EEDWPT 556
            |..::|||.:|.||.:.|........:||||.||       |....:||..|.|     ||...:
Mouse   263 PDLKKLVWIVSRRTAQNLHSSYYSVPELPTIPEG-------GCFDGSESEDSGEDMSCGEESLSS 320

  Fly   557 SPIIPIFEQC 566
            ||  |..::|
Mouse   321 SP--PSDQEC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 31/80 (39%)
Ccng2NP_031661.3 Cyclin_N <74..153 CDD:278560 32/79 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..324 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9767
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4878
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm42876
orthoMCL 1 0.900 - - OOG6_110423
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.820

Return to query results.
Submit another query.