DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccng1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_033961.1 Gene:Ccng1 / 12450 MGIID:102890 Length:294 Species:Mus musculus


Alignment Length:317 Identity:92/317 - (29%)
Similarity:152/317 - (47%) Gaps:42/317 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 LHALTSD------ELYETLKEYDVLQDKFHTVLLLPKESRRE----VTAGGRDGSAYVLRCLKMW 286
            :..||:|      :|...|::....|.|...:.|:  ||..:    :||..||.....|..|..:
Mouse     2 IEVLTTDSQKLLHQLNTLLEQESRCQPKVCGLKLI--ESAHDNGLRMTARLRDFEVKDLLSLTQF 64

  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQL-DLKPIP-AEDLVTISQCGCT 349
            :...::....|::|:||||.:|.|:.||:.|:.::.|:||:|.. :.:.:| |.||:.|||...|
Mouse    65 FGFDTETFSLAVNLLDRFLSKMKVQAKHLGCVGLSCFYLAVKATEEERNVPLATDLIRISQYRFT 129

  Fly   350 AGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRN-LAKEIGGDFFKFYQQLIKLEELENR 413
            ..||.||..::..|:..::  ...|:..:|::||:|..: |..|...|        :..|.||.:
Mouse   130 VSDLMRMEKIVLEKVCWKV--KATTAFQFLQLYYSLVHDTLPFERRND--------LNFERLEAQ 184

  Fly   414 LEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKHV--FEYILFLQQYMRIPDRVF 476
            |:...|.:..:...||.|||.::.|.:.            .||:|  .|.:..:|::.:|..|..
Mouse   185 LKACHCRIIFSKAKPSVLALSILALEIQ------------ALKYVELTEGVECIQKHSKISGRDL 237

  Fly   477 TCGFSIVSGILSHYNGQNKA--PYKQRLVWKLSSRTLRVLRPINRFSSDLPTIEEGI 531
            |....:||..|:.|: .||.  |..|:|.|.:|.||.|.|:......:.||||.|.|
Mouse   238 TFWQELVSKCLTEYS-SNKCSKPNGQKLKWIVSGRTARQLKHSYYRITHLPTIPETI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 28/79 (35%)
Ccng1NP_033961.1 Cyclin_N 16..148 CDD:278560 41/133 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9767
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2995
Inparanoid 1 1.050 109 1.000 Inparanoid score I4878
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003985
OrthoInspector 1 1.000 - - otm42876
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10177
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2747
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.920

Return to query results.
Submit another query.