DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnf

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_006523617.1 Gene:Ccnf / 12449 MGIID:102551 Length:790 Species:Mus musculus


Alignment Length:384 Identity:74/384 - (19%)
Similarity:132/384 - (34%) Gaps:132/384 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QDHQDHPAALLNGPHNNNIGLAMDAHSINAI--LVDDEQPSTSAQAAAAAAASAGGSAGAGSGSG 148
            |..:.|.|::|              |.:..:  |.:||:....|::..             ..|.
Mouse   190 QLQRSHKASIL--------------HCLGRVLNLFEDEEKRKQARSLL-------------EESS 227

  Fly   149 LGGAIGGGKLANGINRNAEMPTDWMRIADEGR----------YGTPGAAGLEYQKYEQQQQLEDL 203
            ..|.:....|....:|..:|       :|.||          |...|.       :|.|     |
Mouse   228 RQGCLISSYLLWESDRKVDM-------SDPGRCLHSFRKLRDYAAKGC-------WEAQ-----L 273

  Fly   204 AESEAGAVGGASNNNGES-SSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVL---LLPKES 264
            |.::|.|.|......|:: |.|:.:|.....|:...:::...|.   |.|....:|   |:...:
Mouse   274 ALAKACAGGSQLGLEGKACSESVCQLFQASQAVNKQQIFSVQKG---LSDTMRYILIDWLVEVAT 335

  Fly   265 RREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKH------MACMSVASF 323
            .::.|:          .||.:..|           .|||:|.|..| |::      :|||.:.:.
Mouse   336 MKDFTS----------LCLHLTVE-----------CVDRYLRRRLV-PRYKLQLLGIACMVICTR 378

  Fly   324 HLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPI-TSVSYLRIYYALFR 387
            .::.:.|.::     :.|.::.......||.|:.|.|.:.|   .|...| |.|.|         
Mouse   379 FISKEILTIR-----EAVWLTDNTYKYEDLVRVMGEIISAL---EGKIRIPTVVDY--------- 426

  Fly   388 NLAKEIGGDFFKFYQQLIKLEELENRLEIL---MCDV-----KTTVITPSTLALVLICL 438
               ||:          |:.|..:..|.:.|   :|::     ..::..|:.||...:.|
Mouse   427 ---KEV----------LLTLVPVAPRTQHLCSFLCELTLLHTSLSIYAPARLASAALLL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/83 (22%)
CcnfXP_006523617.1 FBOX 48..86 CDD:197608
Cyclin_N 296..419 CDD:365896 30/155 (19%)
Cyclin_C 438..544 CDD:367282 7/35 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.