DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccne2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001032211.1 Gene:Ccne2 / 12448 MGIID:1329034 Length:404 Species:Mus musculus


Alignment Length:214 Identity:40/214 - (18%)
Similarity:85/214 - (39%) Gaps:34/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 SDELYETL--KEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKM-W-------YELPS 291
            |.|:::.:  ||...:.||...||....|.:              :|.:.: |       |.|..
Mouse   110 SQEVWQNMLQKENRYVHDKHFQVLHSDLEPQ--------------MRSILLDWLLEVCEVYTLHR 160

  Fly   292 DVLFSAMSLVDRF-LDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLER 355
            :..:.|....||| |.:..|....:..:.:.|..:|.|..::.....::...::...|:..|:.:
Mouse   161 ETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILK 225

  Fly   356 MAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQ--LIKLEELENRLEILM 418
            |...|...|..::  .|:|.:|:|.::..:  :..|::.......|.|  .|::.:|   |::.:
Mouse   226 MELNILKALKWEL--CPVTVISWLNLFLQV--DAVKDVPKVLLPQYSQETFIQIAQL---LDLCI 283

  Fly   419 CDVKTTVITPSTLALVLIC 437
            ..:.:.......||...:|
Mouse   284 LAIDSLEFQYRILAAAALC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 15/78 (19%)
Ccne2NP_001032211.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
Cyclin_N 112..239 CDD:365896 26/142 (18%)
Cyclin_C 241..361 CDD:367282 12/67 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.