DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccne1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_031659.2 Gene:Ccne1 / 12447 MGIID:88316 Length:408 Species:Mus musculus


Alignment Length:260 Identity:44/260 - (16%)
Similarity:94/260 - (36%) Gaps:81/260 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 DELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVD 302
            ||.:  |:.:.:||.:...|||                 .:::...:: |:|..:..:.|....|
Mouse   128 DEHF--LQRHPLLQARMRAVLL-----------------DWLMEVCEV-YKLHRETFYLAQDFFD 172

  Fly   303 RFLDRMAVKPKH------MACMSVASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIA 361
            |::     ..:|      :..:.:::..:|.|..::.|........::...|:..::..|..::.
Mouse   173 RYM-----ASQHNIIKTLLQLIGISALFIASKLEEIYPPKLHQFAYVTDGACSGDEILTMELMMM 232

  Fly   362 NKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELE--------------- 411
            ..|..::  :|:|.||:|.:|..:  ....:.|......|.|.:.::..|               
Mouse   233 KALKWRL--SPLTIVSWLNVYVQV--AYVNDTGEVLMPQYPQQVFVQIAELLDLCVLDVGCLEFP 293

  Fly   412 ------------NRLEILM-------CDVKTTVITPSTLALVLICLHLDFHIKESYTRGSPELKH 457
                        :.||::.       ||::..|......|:|         |:|   .||.:|||
Mouse   294 YGVLAASALYHFSSLELMQKVSGYQWCDIEKCVKWMVPFAMV---------IRE---MGSSKLKH 346

  Fly   458  457
            Mouse   347  346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 11/83 (13%)
Ccne1NP_031659.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Cyclin_N 113..240 CDD:278560 20/138 (14%)
Cyclin_C 243..362 CDD:281044 23/118 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.