DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccnf

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_038941012.1 Gene:Ccnf / 117524 RGDID:67401 Length:818 Species:Rattus norvegicus


Alignment Length:383 Identity:74/383 - (19%)
Similarity:132/383 - (34%) Gaps:130/383 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QDHQDHPAALLNGPHNNNIGLAMDAHSINAI--LVDDEQPSTSAQAAAAAAASAGGSAGAGSGSG 148
            |..:.|.|::|              |.:..:  |.:||:....|......:|..           
  Rat   215 QLQRSHKASIL--------------HCLGRVLNLFEDEEKRKQAHNLFEESAHQ----------- 254

  Fly   149 LGGAIGGGKLANGINRNAEMPTDWMRIADEGR----------YGTPGAAGLEYQKYEQQQQLEDL 203
              |.:....|....:|..:|       :|.||          |...|.       :|.|     |
  Rat   255 --GCLASSYLLWESDRKVDM-------SDPGRCLHSFRKLRDYAAKGC-------WEAQ-----L 298

  Fly   204 AESEAGAVGGASNNNGES-SSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVL---LLPKES 264
            |.::|.|.|......|:: |.|:.:|.....|:...:::...|.   |.|....:|   |:...:
  Rat   299 ALAKACAGGSQLGLEGKACSESVCQLFQASQAVNKQQIFSVQKG---LSDTMRYILIDWLVEVAT 360

  Fly   265 RREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKH------MACMSVASF 323
            .::.|:          .||.:..|           .|||:|.|..| |::      :|||.:.:.
  Rat   361 MKDFTS----------LCLHLTVE-----------CVDRYLRRRLV-PRYKLQLLGIACMVICTR 403

  Fly   324 HLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRN 388
            .::.:.|.::     :.|.::.......||.|:.|.|.:.|..:: ..| |.|.|          
  Rat   404 FISKEILTIR-----EAVWLTDNTYKYEDLVRVMGEIISALEGKI-RIP-TVVDY---------- 451

  Fly   389 LAKEIGGDFFKFYQQLIKLEELENRLEIL---MCDV-----KTTVITPSTLALVLICL 438
              ||:          |:.|..:..|.:.|   :|::     ..:|..|:.||...:.|
  Rat   452 --KEV----------LLTLVPVAPRTQHLCSFLCELTLLHTSLSVYAPARLASAALLL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/83 (22%)
CcnfXP_038941012.1 FBOX 73..111 CDD:197608
CYCLIN_CCNF_rpt1 345..439 CDD:410225 24/120 (20%)
CYCLIN_CCNF_rpt2 467..578 CDD:410226 7/31 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.