DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and Ccna2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_008759125.1 Gene:Ccna2 / 114494 RGDID:621059 Length:445 Species:Rattus norvegicus


Alignment Length:424 Identity:86/424 - (20%)
Similarity:143/424 - (33%) Gaps:107/424 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 STLQQQQQLHLQQQYEQYQHYQYQREQDIAYYCQLQAARQQEQLMQQRTSMSSSVMPGLALPQDH 88
            |.|..||:.......|:....|..|.|.:....:::....|::|..:|      |.|...||   
  Rat    10 SALLSQQEDQENVNPEKVAPAQQPRAQAVLKAGKVRGPAPQQRLKTRR------VAPLKDLP--- 65

  Fly    89 QDHPAALLNGPHNNNI--GLAMDAHSINAILVDD---------EQPSTSAQAAAAAAASAGGSAG 142
                   :|..|...:  ..|:.......|.||:         ||..|..:.|.|.:|:.     
  Rat    66 -------INDEHVPTVPSWKAVSKQPAFTIHVDEAEETQKRPAEQKETQCEDALAFSAAV----- 118

  Fly   143 AGSGSGLGGAIGGGKLANGINRNAEMPTDWMRIADEGRYGTPGAAGLEYQKYEQQQQLEDLAESE 207
                 .|.||           |...:|.|:..   :|.:|.  ..|.:...|.|..:..||.   
  Rat   119 -----SLPGA-----------RKPLVPLDYPM---DGSFGQ--THGRQNSCYRQLCRCYDLT--- 159

  Fly   208 AGAVGGASNNNGESSSSLKKLEDQLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGG 272
                  ....:.||..::     .:..:..||....:.|.....:..||.|       ||:....
  Rat   160 ------VETRDVESPHAM-----DISIVLEDEKPVNVNEVPDYHEDIHTYL-------REMEVKC 206

  Fly   273 RDGSAYVLR----------CLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSV 320
            :...:|:.|          .|..|       |:|.::.|..|::.:||||..|:|....:..:..
  Rat   207 KPKVSYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGT 271

  Fly   321 ASFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYY-- 383
            |:..||.|..::.|....:.|.|:....:...:.||..::...|...:. || |...:|..|:  
  Rat   272 AAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLA-AP-TVNQFLTQYFLH 334

  Fly   384 -----------ALFRNLAKEIGGD-FFKFYQQLI 405
                       |:|......|..| :.|:...||
  Rat   335 LQPANCKVESLAMFLGELSLIDADPYLKYLPSLI 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 19/77 (25%)
Ccna2XP_008759125.1 Cyclin_N2 17..174 CDD:293109 38/212 (18%)
Cyclin_N 194..320 CDD:278560 29/132 (22%)
Cyclin_C 322..440 CDD:281044 11/48 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.