DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNI

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001335061.1 Gene:CCNI / 10983 HGNCID:1595 Length:377 Species:Homo sapiens


Alignment Length:313 Identity:69/313 - (22%)
Similarity:129/313 - (41%) Gaps:62/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 SRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIK 328
            |.:.|:...||.....|..||..:.|..:....|.||:||||..:...||:::|::::.|.||.|
Human    36 SNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLSCIAISCFFLAAK 100

  Fly   329 QLDL-KPIPA-EDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAK 391
            .::. :.||. :.|...|.|||::.::.||..:|.:||...:..|  |.:.:|.|::|:..:...
Human   101 TVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTA--TPLDFLHIFHAIAVSTRP 163

  Fly   392 EIGGDFFKFYQQLIKLEEL----------ENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKE 446
            ::          |..|.:|          :..|..:.|: :......|.|||.::.|.::..|.:
Human   164 QL----------LFSLPKLSPSQHLAVLTKQLLHCMACN-QLLQFRGSMLALAMVSLEMEKLIPD 217

  Fly   447 --SYTRGSPELKHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAPYKQRLVWKLSSR 509
              |.|            |..||:......::..|     ..:::|        :...|...|...
Human   218 WLSLT------------IELLQKAQMDSSQLIHC-----RELVAH--------HLSTLQSSLPLN 257

  Fly   510 TLRVLRPINRFSSDLPTIEEGIPNALDDGLRSRTESISSEEEEDWPTSPIIPI 562
            ::.|.||:..   .|.|.::|:       .|....|:...:.....:.|.:|:
Human   258 SVYVYRPLKH---TLVTCDKGV-------FRLHPSSVPGPDFSKDNSKPEVPV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 26/79 (33%)
CCNINP_001335061.1 Cyclin_N 34..142 CDD:365896 34/105 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 357..377
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9622
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40801
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.