DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and CCNO

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_066970.3 Gene:CCNO / 10309 HGNCID:18576 Length:350 Species:Homo sapiens


Alignment Length:289 Identity:63/289 - (21%)
Similarity:105/289 - (36%) Gaps:84/289 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 PGAAGLEYQKYEQQQQLEDLAESEAGAVGGAS----------------NNNGESSSSLKKLEDQL 232
            ||.:|: ...:|......|.|||.:.|.||:.                .:.|:|..:.:|.:   
Human    52 PGDSGI-CDLFESPSSGSDGAESPSAARGGSPLPGPAQPVAQLDLQTFRDYGQSCYAFRKAQ--- 112

  Fly   233 HALTSDELYETLKEYDVLQDKFHTVLLLPKES---RREVTAGGRDGSAYVLRC-LKMW------- 286
                              :..||     |:|:   :.:|||..        || |..|       
Human   113 ------------------ESHFH-----PREALARQPQVTAES--------RCKLLSWLIPVHRQ 146

  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPAEDLVTISQCGC-TA 350
            :.|..:.|...::.:||||....|.......:.|.|..:|.||:::.|...:.|:.:. ||. :.
Human   147 FGLSFESLCLTVNTLDRFLTTTPVAADCFQLLGVTSLLIACKQVEVHPPRVKQLLALC-CGAFSR 210

  Fly   351 GDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENR-- 413
            ..|..:..::.:||...:| ||..|     .:...|.:...|.|        |....|.||.:  
Human   211 QQLCNLECIVLHKLHFTLG-APTIS-----FFLEHFTHARVEAG--------QAEASEALEAQAL 261

  Fly   414 ----LEILMCDVKTTVITPSTLALVLICL 438
                .|:.:.|...|..:||.||:..:.|
Human   262 ARGVAELSLADYAFTSYSPSLLAICCLAL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/78 (23%)
CCNONP_066970.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 11/37 (30%)
Cyclin_N 108..229 CDD:278560 31/155 (20%)
Cyclin_C 231..>296 CDD:281044 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.