DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and XB997834

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_017951851.1 Gene:XB997834 / 100487861 XenbaseID:XB-GENE-997835 Length:327 Species:Xenopus tropicalis


Alignment Length:108 Identity:26/108 - (24%)
Similarity:54/108 - (50%) Gaps:6/108 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   287 YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPIPA--EDLVTISQCGCT 349
            ::|..:.|..|::.::|||....:|..::..|.....:||.|.:: |.:|.  :.|....:.|.|
 Frog   107 FKLDFETLCLAVNYLERFLACTPLKAANLKVMGGTCLYLACKVME-KSLPKINQFLALFCEDGFT 170

  Fly   350 AGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKE 392
            |..:..:..::..:|..::| ||  ::.|...:::|.|...||
 Frog   171 APLMSYLERLVLRRLCFRLG-AP--TIEYFLEHFSLRRVSNKE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 17/79 (22%)
XB997834XP_017951851.1 Cyclin_N 66..190 CDD:365896 18/83 (22%)
Cyclin_C 192..>268 CDD:367282 6/21 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.