DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccni2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_003200952.1 Gene:ccni2 / 100330479 ZFINID:ZDB-GENE-081106-2 Length:310 Species:Danio rerio


Alignment Length:219 Identity:48/219 - (21%)
Similarity:95/219 - (43%) Gaps:38/219 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 DVLQDKFHTVLLLPKESRREVTAGGRDGSAYVLRCLKMWYELPSDVLFSAMSLVDRFLDRMAVKP 312
            |:...::|.|:|.                   ||.:.:.::..::.|...:.:::..|..:..:.
Zfish    41 DISPSQYHEVILW-------------------LREMNVIFQFSTETLALGVCVLNSLLATVKTQL 86

  Fly   313 KHMACMSVASFHLA--IKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITS 375
            |::.||::.|..||  |.:.|......:||:..|:|..:..::.||..||.:||..::..|  |.
Zfish    87 KYLKCMAITSLILAAKINEEDEVIASVKDLLEQSRCKFSTAEILRMERVILHKLHWELYLA--TP 149

  Fly   376 VSYLRIYYALFRNLAKEIGGDFFKFYQQLIKLEELENR-LEILMCDVKTTVITPSTLALVLICLH 439
            :.::.|::.|.      :.|...:..::|.....|.:| |:..|...:......|.|||.:|.|.
Zfish   150 MDFIHIFHGLL------MSGCVDQTQKRLCLQAALWSRQLQHCMACHQLWQFKGSILALAIITLE 208

  Fly   440 LDFHIKESYTRGSPELKHVFEYIL 463
            |:        |.:|:...||..:|
Zfish   209 LE--------RLTPDWFSVFTGLL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 19/79 (24%)
ccni2XP_003200952.1 Cyclin_N 36..144 CDD:278560 26/121 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.