DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccnb2

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:NP_001138848.1 Gene:ccnb2 / 100270772 XenbaseID:XB-GENE-1005599 Length:390 Species:Xenopus tropicalis


Alignment Length:331 Identity:64/331 - (19%)
Similarity:119/331 - (35%) Gaps:75/331 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   222 SSSLKKLED---------QLHALTSDELYETLKEYDVLQDKFHTVLLLPKESRREVTAGGRDGSA 277
            |::|..:||         ||.:....::|..||:.:|            ::|.|.....|::.:.
 Frog   106 SNALTNVEDIDADDGGNPQLCSGYVMDIYNYLKQLEV------------QQSVRPCYLEGKEINE 158

  Fly   278 YVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVASFHLAIKQLDLKPI 335
            .:...|..|       ::|..:.|:..::::||||....|....:..:.|.|..:|.|..::...
 Frog   159 RMRAILVDWIVQVHSRFQLLQETLYMGIAIMDRFLQVQPVSRSKLQLVGVTSLLVASKYEEMYTP 223

  Fly   336 PAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALFRNLAKEIGGDFFKF 400
            ...|.|.|:....||..:..|..:|...|...:|..       |.:::  .|..:|....|    
 Frog   224 EVADFVYITDNAYTASQIREMEMIILRVLNFDLGRP-------LPLHF--LRRASKSCSAD---- 275

  Fly   401 YQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDF----------HIKESYTRGSPEL 455
            .:|....:.|   :|:.:.|.:.....||.:|...:||....          |....||....:|
 Frog   276 AEQHTLAKYL---MELTLIDYEMVHFNPSEIAAAALCLSQKILAQGSWGATQHYYTGYTESDLQL 337

  Fly   456 --KHVFEYILFLQQYMRIPDRVFTCGFSIVSGILSHYNGQNKAPYKQRLVWKLSSRTLRVLRPIN 518
              ||:.:.:..:.|                 .:..|...:||  |....:.|:|:....:...|.
 Frog   338 VMKHMAKNLTKVNQ-----------------NLTKHVAVRNK--YASSKLMKISTLPQLMAPLIT 383

  Fly   519 RFSSDL 524
            ..|:.|
 Frog   384 ELSASL 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 18/77 (23%)
ccnb2NP_001138848.1 Cyclin_N2 <113..372 CDD:330468 58/305 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.