DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CycG and ccnb1

DIOPT Version :9

Sequence 1:NP_001263146.1 Gene:CycG / 43724 FlyBaseID:FBgn0039858 Length:566 Species:Drosophila melanogaster
Sequence 2:XP_031753568.1 Gene:ccnb1 / 100101736 XenbaseID:XB-GENE-921525 Length:392 Species:Xenopus tropicalis


Alignment Length:335 Identity:69/335 - (20%)
Similarity:125/335 - (37%) Gaps:71/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GKLANGINRNAEMPTDWMRIADEGRYGTPGAAGLEYQKYEQQQQLEDLAESEAGAVGGASNNNGE 220
            |.:.|.|:: |::|   ::.|.:.....|      .:|.|:....||....||......|.|..|
 Frog    40 GDIGNQISK-AKVP---LKRATKALRKPP------VEKSEKLIVPEDYVPKEAETPVPDSPNPME 94

  Fly   221 S------------SSSLKKLEDQLHALTSD----------ELYETLKEYDVLQDKFHTVLLLPKE 263
            :            ||:|..::| :.|..||          ::|..|:..:|            |:
 Frog    95 TSVCVIEEIPPAFSSALIPIKD-VDAEDSDNPMLCSDYVKDIYCYLRNMEV------------KQ 146

  Fly   264 SRREVTAGGRDGSAYVLRCLKMW-------YELPSDVLFSAMSLVDRFLDRMAVKPKHMACMSVA 321
            :.|.....|::.:..:...|..|       ::|..:.:...::::||||....|..|.:....|:
 Frog   147 AIRPRYLDGQEINGNMRAILVDWLVQVHLRFKLLQETMSMTIAILDRFLQENPVPKKLLQLAGVS 211

  Fly   322 SFHLAIKQLDLKPIPAEDLVTISQCGCTAGDLERMAGVIANKLGVQMGHAPITSVSYLRIYYALF 386
            :..:|.|..::......|...::....|...:..|...|...|...:|. |: .:.:||      
 Frog   212 AMFIACKYEEIYCPSIGDFAFVTDHTYTKSQIRNMEMQILRVLKFDIGR-PL-PLHFLR------ 268

  Fly   387 RNLAKEIGGDFFKFYQQLIKLEELENRLEILMCDVKTTVITPSTLALVLICLHLDFHIKESYTRG 451
              .|.:| |:....:..|.|.     .:|::|.|.....:.||.||....||.:.......:|  
 Frog   269 --RASKI-GEVDSVHHTLAKY-----LIELVMTDYDMVHVPPSQLAAAAFCLAMKILNSGEWT-- 323

  Fly   452 SPELKHVFEY 461
             |.|:|...|
 Frog   324 -PVLEHYMAY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CycGNP_001263146.1 CYCLIN <287..365 CDD:294043 14/77 (18%)
ccnb1XP_031753568.1 CYCLIN_SF 128..256 CDD:424085 23/139 (17%)
CYCLIN_SF 261..381 CDD:424085 22/90 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.