DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and RPL6A

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_013638.1 Gene:RPL6A / 854902 SGDID:S000004538 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:189 Identity:80/189 - (42%)
Similarity:106/189 - (56%) Gaps:24/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 KKSKASYPT-------KTFVKKRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLLKVLA 139
            :|:...||:       ||....||.|         .|.:|.|||||||||||.:|||||.||.|.
Yeast     4 QKAPKWYPSEDVAALKKTRKAARPQK---------LRASLVPGTVLILLAGRFRGKRVVYLKHLE 59

  Fly   140 SGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLK-AKKDKKTGEADI 203
            ...||::|||.:|..|||||:.||||.||:||.:....| |..|..||.:.| .||:||  ||::
Yeast    60 DNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNV-EKFNVEYFAKEKLTKKEKK--EANL 121

  Fly   204 FAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRMRF 262
            |..::.:.:..| |.:|||.||.||:..||..|   ...:||...|:|.:...||.::|
Yeast   122 FPEQQNKEIKAE-RVEDQKVVDKALIAEIKKTP---LLKQYLSASFSLKNGDKPHMLKF 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813
KOW_RPL6 106..262 CDD:240520 71/156 (46%)
RPL14A 111..234 CDD:225074 63/123 (51%)
RPL6ANP_013638.1 KOW_RPL6 26..176 CDD:240520 74/165 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341314
Domainoid 1 1.000 68 1.000 Domainoid score I2326
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I1314
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53785
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - otm46919
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - O PTHR10715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1143
SonicParanoid 1 1.000 - - X1520
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.