DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and RPL27B

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_010759.1 Gene:RPL27B / 852082 SGDID:S000002879 Length:136 Species:Saccharomyces cerevisiae


Alignment Length:164 Identity:35/164 - (21%)
Similarity:55/164 - (33%) Gaps:69/164 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LTPGTVLILLAGRHQGKRVVLLKVLASGL-------LLVTG------------------------ 147
            |..|.|.:::.||:.||:||::|....|.       .||.|                        
Yeast     5 LKAGKVAVVVRGRYAGKKVVIVKPHDEGSKSHPFGHALVAGIERYPSKVTKKHGAKKVAKRTKIK 69

  Fly   148 PFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTGEADIFAAKKERFV 212
            ||      ::.|:..:::.|...:|:.|||                          .....|.|.
Yeast    70 PF------IKVVNYNHLLPTRYTLDVEAFK--------------------------SVVSTETFE 102

  Fly   213 PNEQRKKDQKEVDAALLKVIKAHPEGK---FFAK 243
            ...||::.:|.|..|.   .:.|..||   ||:|
Yeast   103 QPSQREEAKKVVKKAF---EERHQAGKNQWFFSK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813
KOW_RPL6 106..262 CDD:240520 35/164 (21%)
RPL14A 111..234 CDD:225074 29/150 (19%)
RPL27BNP_010759.1 KOW 1..136 CDD:294253 35/164 (21%)
RPL14A 1..128 CDD:225074 32/157 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.