DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and AT1G74060

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_177546.1 Gene:AT1G74060 / 843746 AraportID:AT1G74060 Length:233 Species:Arabidopsis thaliana


Alignment Length:259 Identity:109/259 - (42%)
Similarity:148/259 - (57%) Gaps:39/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KSAKKGKKHPVNSYLKGGILRYSKAQMYKRRALYRLKDKKSPVV----EKAKV--PIKKVKKIGG 70
            ::||..:    |..|..|:.:||::|||.:|.|:.:|.|...|.    .|:||  |::|..|.  
plant     6 RTAKVNR----NPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAKSKVDAPVEKPPKF-- 64

  Fly    71 PKNGGERTVFLKKSKASYPTKTFVKKRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRVVLL 135
                             ||.:...|..|::......|  .|.::|||||||:||||.:|||||.|
plant    65 -----------------YPAEDVKKPLPNRRTAKPAK--LRASITPGTVLIILAGRFKGKRVVFL 110

  Fly   136 KVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKKTGE 200
            |.||||||||||||.:|..|||||:|.||||||:|||:....: :..:|.||.::..||.||| |
plant   111 KQLASGLLLVTGPFKINGVPLRRVNQAYVIGTSTKVDISGVTL-DKFDDKYFGKVAEKKKKKT-E 173

  Fly   201 ADIFAAKKE--RFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRMRF 262
            .:.|.|:||  :.:| :.:|.|||.|||||:|.|:|.||.|   .||...|:|.....||.:.|
plant   174 GEFFEAEKEEKKEIP-QGKKDDQKAVDAALIKAIEAVPELK---TYLGARFSLKQGMKPHELVF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 11/27 (41%)
KOW_RPL6 106..262 CDD:240520 83/157 (53%)
RPL14A 111..234 CDD:225074 72/124 (58%)
AT1G74060NP_177546.1 Ribosomal_L6e_N 2..61 CDD:367701 19/58 (33%)
KOW_RPL6 81..233 CDD:240520 83/159 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 85 1.000 Domainoid score I2820
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31001
Inparanoid 1 1.050 159 1.000 Inparanoid score I1646
OMA 1 1.010 - - QHG53785
OrthoDB 1 1.010 - - D1227453at2759
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - otm3035
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1520
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.