DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and AT1G18540

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_173289.1 Gene:AT1G18540 / 838435 AraportID:AT1G18540 Length:233 Species:Arabidopsis thaliana


Alignment Length:262 Identity:108/262 - (41%)
Similarity:144/262 - (54%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SAKKGKKHPVNSYLKGGILRYSKAQMYKRRALYRLKDKKSPVV------EKAKVPIKKVKKIGGP 71
            :||:..|...|..|..|:.:||::|||.:|.|:.:|.|...|.      .|...|::|..|.   
plant     3 AAKRTPKVNRNPDLIRGVGKYSRSQMYHKRGLWAIKAKNGGVFPRHDAQPKVDAPVEKPAKF--- 64

  Fly    72 KNGGERTVFLKKSKASYPT----KTFVKKRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQGKRV 132
                            ||.    |..|.:|..|..      ..:.::|||||||:||||.:||||
plant    65 ----------------YPAEDVKKPLVNRRKPKPT------KLKASITPGTVLIILAGRFKGKRV 107

  Fly   133 VLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYFRRLKAKKDKK 197
            |.||.|:||||||||||.:|..|||||:|.||||||:|:|:..... |..:|.||.::..||.||
plant   108 VFLKQLSSGLLLVTGPFKINGVPLRRVNQAYVIGTSTKIDISGVNT-EKFDDKYFGKVAEKKKKK 171

  Fly   198 TGEADIFAAKKE--RFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPHRM 260
            | |.:.|.|:||  :.:|.| :|:|||.|||||:|.|:|.||.|.   ||...|:|.....||.:
plant   172 T-EGEFFEAEKEEKKEIPQE-KKEDQKTVDAALIKSIEAVPELKV---YLGARFSLSQGMKPHEL 231

  Fly   261 RF 262
            .|
plant   232 VF 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 11/27 (41%)
KOW_RPL6 106..262 CDD:240520 81/157 (52%)
RPL14A 111..234 CDD:225074 71/124 (57%)
AT1G18540NP_173289.1 Ribosomal_L6e_N 2..54 CDD:281813 16/50 (32%)
KOW_RPL6 81..233 CDD:240520 82/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 85 1.000 Domainoid score I2820
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31001
Inparanoid 1 1.050 159 1.000 Inparanoid score I1646
OMA 1 1.010 - - QHG53785
OrthoDB 1 1.010 - - D1227453at2759
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - otm3035
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1520
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.840

Return to query results.
Submit another query.