DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and Rpl14

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_080250.1 Gene:Rpl14 / 67115 MGIID:1914365 Length:217 Species:Mus musculus


Alignment Length:124 Identity:35/124 - (28%)
Similarity:50/124 - (40%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGA 175
            ||.:..|.|..:..|.|.||.|.::.|:.....||.||     |  .||.::.:.....::....
Mouse     4 RRYVEVGRVAYISFGPHAGKLVAIVDVIDQNRALVDGP-----C--TRVRRQAMPFKCMQLTDFI 61

  Fly   176 FKVPEHLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKA 234
            .|.|......|.|:...|.|..|..|....|||     .:.|::..|..|....||:||
Mouse    62 LKFPHSARQKYVRKAWEKADINTKWAATRWAKK-----IDARERKAKMTDFDRFKVMKA 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813
KOW_RPL6 106..262 CDD:240520 35/124 (28%)
RPL14A 111..234 CDD:225074 33/122 (27%)
Rpl14NP_080250.1 PTZ00065 2..128 CDD:240252 35/124 (28%)
KOW_RPL14 7..81 CDD:240512 20/80 (25%)
Ribosomal_L14e 47..120 CDD:280163 18/74 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..217
4 X 5 AA tandem repeats of Q-K-A-[APS]-X 173..192
2 X 3 AA tandem repeats of K-G-Q 195..200
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.