DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and Rpl14

DIOPT Version :10

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_080250.1 Gene:Rpl14 / 67115 MGIID:1914365 Length:217 Species:Mus musculus


Alignment Length:124 Identity:35/124 - (28%)
Similarity:50/124 - (40%) Gaps:12/124 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 RRNLTPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGA 175
            ||.:..|.|..:..|.|.||.|.::.|:.....||.||     |  .||.::.:.....::....
Mouse     4 RRYVEVGRVAYISFGPHAGKLVAIVDVIDQNRALVDGP-----C--TRVRRQAMPFKCMQLTDFI 61

  Fly   176 FKVPEHLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKA 234
            .|.|......|.|:...|.|..|..|....|||     .:.|::..|..|....||:||
Mouse    62 LKFPHSARQKYVRKAWEKADINTKWAATRWAKK-----IDARERKAKMTDFDRFKVMKA 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 KOW_RPL6 106..262 CDD:240520 35/124 (28%)
Rpl14NP_080250.1 eL14 5..123 CDD:467915 34/123 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..217
4 X 5 AA tandem repeats of Q-K-A-[APS]-X 173..192
2 X 3 AA tandem repeats of K-G-Q 195..200
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.