DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and Rpl6l

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_036012022.1 Gene:Rpl6l / 432502 MGIID:3647789 Length:309 Species:Mus musculus


Alignment Length:265 Identity:123/265 - (46%)
Similarity:162/265 - (61%) Gaps:21/265 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AKKV---AKSAKKGKKH-PVNSYLKGGILRYSKAQMYKRRALYRLK--------DKKSPVVEKAK 59
            ||||   .|..||.|.| ..|..|..||.|||::.||.|:|||:.|        :||.   :|.|
Mouse    34 AKKVHPKGKKPKKAKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKTKVEKKK---KKEK 95

  Fly    60 VPIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPS--KANFSEHKRNTRRNLTPGTVLIL 122
            |.....|.:||.||||.|.|.|:|....|||:...:|..|  |..||:|.|..|.::||.|:||:
Mouse    96 VLATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPRTLLII 160

  Fly   123 LAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYF 187
            |||||:|||||.:|.|.|||||||||..:|..||||..|::||.||:|||:...|:|:||.||||
Mouse   161 LAGRHRGKRVVFVKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVKIPKHLTDAYF 225

  Fly   188 RRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALH 252
            ::.:.:|.:.. |.:||..:||::...||||.|||.||..:|..|||.|:   ...||::.|:|.
Mouse   226 KKKQLRKPRHQ-EGEIFDTEKEKYEITEQRKADQKAVDLQILPKIKAVPQ---LQGYLRSQFSLT 286

  Fly   253 SSQYP 257
            :..||
Mouse   287 NGMYP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 14/35 (40%)
KOW_RPL6 106..262 CDD:240520 76/152 (50%)
RPL14A 111..234 CDD:225074 65/122 (53%)
Rpl6lXP_036012022.1 Ribosomal_L6e_N 50..103 CDD:397788 20/55 (36%)
KOW_RPL6 144..291 CDD:240520 74/150 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31001
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.