DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and rpl6

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001003844.2 Gene:rpl6 / 336727 ZFINID:ZDB-GENE-030131-8671 Length:265 Species:Danio rerio


Alignment Length:278 Identity:128/278 - (46%)
Similarity:176/278 - (63%) Gaps:29/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPIEKAKKVAKSAKKGKKHPVNSYLKGGILRYSKAQMYKRRALY-------------RLKDKKS 52
            ||..:| ||||:  |.|.::|   .|..||.|||::.|:.|||:|             ::|:|| 
Zfish     1 MAEGDK-KKVAR--KHGSRNP---ELVRGIGRYSRSAMFARRAMYKRKTKAPVTKVEKKIKEKK- 58

  Fly    53 PVVEKAKVPIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPS---KANFSEHKRNTRRNL 114
             |.:|:|.|...:|.:||.||||.|.|.|:|....|||:...:|..|   || ||:|:|..|:.:
Zfish    59 -VKQKSKNPTTAIKTVGGDKNGGTRVVKLRKMPRYYPTEDVRRKLRSHGIKA-FSQHRRKLRKTI 121

  Fly   115 TPGTVLILLAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVP 179
            |||||||:|.|||:|||||.||.|.|||||||||.|:|..||||..|::.|.|::|||:...|:|
Zfish   122 TPGTVLIMLTGRHRGKRVVFLKQLDSGLLLVTGPLAINRVPLRRAHQKFCIATNTKVDISGMKIP 186

  Fly   180 EHLNDAYFRRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKY 244
            ..|.|:||::.|.:|.|.. |.:||..:||::...||||.|||.||:.||.:||..|:   ...|
Zfish   187 RTLTDSYFKKKKLRKPKHQ-EGEIFDTEKEKYQLTEQRKADQKAVDSQLLPLIKKVPQ---LRGY 247

  Fly   245 LQNMFALHSSQYPHRMRF 262
            |::||:|.:..|||::.|
Zfish   248 LRSMFSLSNGVYPHKLVF 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 12/40 (30%)
KOW_RPL6 106..262 CDD:240520 79/155 (51%)
RPL14A 111..234 CDD:225074 67/122 (55%)
rpl6NP_001003844.2 Ribosomal_L6e_N 6..>48 CDD:281813 19/47 (40%)
KOW_RPL6 113..265 CDD:240520 79/155 (51%)
RPL14A 117..241 CDD:225074 68/124 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573348
Domainoid 1 1.000 95 1.000 Domainoid score I7369
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31001
Inparanoid 1 1.050 213 1.000 Inparanoid score I3617
OMA 1 1.010 - - QHG53785
OrthoDB 1 1.010 - - D1227453at2759
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - oto41730
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1143
SonicParanoid 1 1.000 - - X1520
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1716.800

Return to query results.
Submit another query.