DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and rpl6

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_588190.1 Gene:rpl6 / 2539372 PomBaseID:SPCC622.18 Length:195 Species:Schizosaccharomyces pombe


Alignment Length:199 Identity:86/199 - (43%)
Similarity:108/199 - (54%) Gaps:11/199 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KIGGPKNGGERTVFLKKSKAS--YPTKTFVKKRPSKANFSEHKRNTRRNLTPGTVLILLAGRHQG 129
            |:.|.||||||.|......|:  ||  .:.:..|.||..:......|.:|.||||.||||||.:|
pombe     5 KVNGAKNGGERMVLPAGEAAAKYYP--AYRENVPKKARKAVRPTKLRASLAPGTVCILLAGRFRG 67

  Fly   130 KRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSS-KVDLGAFKVPEHLNDAYFRRLKAK 193
            ||||:|..| ...|:||||:.:|..|:|||:.||||.||: |:|:....| |....|||.:.|..
pombe    68 KRVVVLSQL-EDTLVVTGPYKVNGVPIRRVNHRYVIATSAPKIDVSGVSV-EKFTKAYFAKQKRS 130

  Fly   194 KDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALHSSQYPH 258
            ...|..|| .||....:.....:|..|||.|||.||..|||.|..|   :||...|||.:...||
pombe   131 GPVKKDEA-FFAENAPKNALPAERIADQKAVDAKLLPAIKAIPNMK---EYLAASFALSNGDRPH 191

  Fly   259 RMRF 262
            .|:|
pombe   192 LMKF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813
KOW_RPL6 106..262 CDD:240520 70/156 (45%)
RPL14A 111..234 CDD:225074 58/123 (47%)
rpl6NP_588190.1 KOW_RPL6 44..195 CDD:240520 70/156 (45%)
RPL14A 48..171 CDD:225074 59/125 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 67 1.000 Domainoid score I2786
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 124 1.000 Inparanoid score I1475
OMA 1 1.010 - - QHG53785
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - oto101809
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1143
SonicParanoid 1 1.000 - - X1520
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.