DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and Rpl6

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038944961.1 Gene:Rpl6 / 117042 RGDID:619826 Length:305 Species:Rattus norvegicus


Alignment Length:270 Identity:126/270 - (46%)
Similarity:168/270 - (62%) Gaps:18/270 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IEKAKKVAKSAKKGKKH-PVNSYLKGGILRYSKAQMYKRRALYRLK--------DKKSPVVEKAK 59
            ::|:...||..:|.|.| ..|..|..||.|||::.||.|:|||:.|        :||.   :|.|
  Rat    43 VKKSSSKAKKLRKSKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYSAAKTKVEKKK---KKEK 104

  Fly    60 VPIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPS--KANFSEHKRNTRRNLTPGTVLIL 122
            |.....|.:||.||||.|.|.|:|....|||:...:|..|  |..||:|.|..|.::|||||||:
  Rat   105 VLATVTKTVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLII 169

  Fly   123 LAGRHQGKRVVLLKVLASGLLLVTGPFALNSCPLRRVSQRYVIGTSSKVDLGAFKVPEHLNDAYF 187
            |.|||:|||||.||.|.|||||||||.|||..||||..|::||.||:|||:...|:|:||.||||
  Rat   170 LTGRHRGKRVVFLKQLGSGLLLVTGPLALNRVPLRRTHQKFVIATSTKVDISKVKIPKHLTDAYF 234

  Fly   188 RRLKAKKDKKTGEADIFAAKKERFVPNEQRKKDQKEVDAALLKVIKAHPEGKFFAKYLQNMFALH 252
            ::...:|.:.. |.:||..:||::...||||.|||.||:.:|..|||.|:   ...||::.|:|.
  Rat   235 KKKPLRKPRHQ-EGEIFDTEKEKYEITEQRKADQKAVDSQILPKIKAVPQ---LQGYLRSQFSLT 295

  Fly   253 SSQYPHRMRF 262
            :..|||::.|
  Rat   296 NGMYPHKLVF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 14/35 (40%)
KOW_RPL6 106..262 CDD:240520 81/155 (52%)
RPL14A 111..234 CDD:225074 69/122 (57%)
Rpl6XP_038944961.1 Ribosomal_L6e_N 58..112 CDD:397788 20/56 (36%)
KOW_RPL6 153..305 CDD:240520 81/155 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334337
Domainoid 1 1.000 98 1.000 Domainoid score I6997
eggNOG 1 0.900 - - E1_COG2163
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31001
Inparanoid 1 1.050 218 1.000 Inparanoid score I3492
OMA 1 1.010 - - QHG53785
OrthoDB 1 1.010 - - D1227453at2759
OrthoFinder 1 1.000 - - FOG0001826
OrthoInspector 1 1.000 - - otm46049
orthoMCL 1 0.900 - - OOG6_101188
Panther 1 1.100 - - LDO PTHR10715
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1520
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.