DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpL6 and LOC103910031

DIOPT Version :9

Sequence 1:NP_651876.1 Gene:RpL6 / 43723 FlyBaseID:FBgn0039857 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_021326481.1 Gene:LOC103910031 / 103910031 -ID:- Length:151 Species:Danio rerio


Alignment Length:149 Identity:64/149 - (42%)
Similarity:88/149 - (59%) Gaps:25/149 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPIEKAKKVAKSAKKGKKHPVNSYLKGGILRYSKAQMYKRRALY-------------RLKDKKS 52
            ||..:| ||||:  |.|.::|   .|..||.|||::.|:.|||:|             ::|:|| 
Zfish     8 MAEGDK-KKVAR--KHGSRNP---ELVRGIGRYSRSAMFARRAMYKRKTKAPVTKVEKKIKEKK- 65

  Fly    53 PVVEKAKVPIKKVKKIGGPKNGGERTVFLKKSKASYPTKTFVKKRPS---KANFSEHKRNTRRNL 114
             |.:|:|.|...:|.:||.||||.|.|.|:|....|||:...:|..|   || |::|:...|..:
Zfish    66 -VKQKSKNPTTAIKTVGGDKNGGTRVVKLRKMPRYYPTEDVRRKLRSHSIKA-FTQHRSKLRNTI 128

  Fly   115 TPGTVLILLAGRHQGKRVV 133
            |||||||:|.|||:|||.|
Zfish   129 TPGTVLIMLTGRHRGKRGV 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpL6NP_651876.1 Ribosomal_L6e_N <23..>51 CDD:281813 12/40 (30%)
KOW_RPL6 106..262 CDD:240520 17/28 (61%)
RPL14A 111..234 CDD:225074 16/23 (70%)
LOC103910031XP_021326481.1 Ribosomal_L6e_N 13..>55 CDD:309115 19/47 (40%)
KOW 120..>147 CDD:320928 16/26 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1227453at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.